PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo15G0002000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family bHLH
Protein Properties Length: 88aa    MW: 9681.94 Da    PI: 8.5057
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo15G0002000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH27.45.9e-0914551455
                     HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
              HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                     d+i++  ++L++llP+a + +s++ s a  L++++ YIksLq
  Spipo15G0002000 14 DDIKELVAKLQSLLPEARRRSSGRTSAAKLLKETCSYIKSLQ 55
                     6899999*********88***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.248154IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.9E-91468IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.5E-61455IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.7E-91475IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MSSGWTGRAR ATDDDIKELV AKLQSLLPEA RRRSSGRTSA AKLLKETCSY IKSLQREVDD  60
LSDRLSDLIS AMDDNSAQAE IIRSLLR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917019.13e-37PREDICTED: transcription factor ILI5-like
SwissprotA2X9L82e-32ILI5_ORYSI; Transcription factor ILI5
SwissprotQ6YUX02e-32ILI5_ORYSJ; Transcription factor ILI5
TrEMBLM0S1X35e-36M0S1X3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P21650_0011e-35(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92838145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.12e-16bHLH family protein